SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495861|ref|YP_003542354.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495861|ref|YP_003542354.1|
Domain Number 1 Region: 2-238
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.1e-87
Family Tryptophan biosynthesis enzymes 0.00000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294495861|ref|YP_003542354.1|
Sequence length 257
Comment tryptophan synthase subunit alpha [Methanohalophilus mahii DSM 5219]
Sequence
MRISQKFEELKDKNEKALIAYVCAGDPDTATTPSIVNALVEAGADIIELGLPFSDPVADG
PTIQAATCRAIEAGMNTERYFEMIKGLEVNVPLVCMTYYNLIYRHGSENFVKRCAEAGIS
GLIIPDLPLHEADELIEICKEEGIDNIFLVAPNTSDQRLDAISSKSSGFIYVVSKLGVTG
EGKNISSNVAGLLDKINSTLPKAVGFGISNRKHVEEMVAAGADAVIVGSALVNIIASKDD
VIPRLKEITKDLKEGCR
Download sequence
Identical sequences D5EC08
WP_013037651.1.50250 gi|294495861|ref|YP_003542354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]