SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495934|ref|YP_003542427.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495934|ref|YP_003542427.1|
Domain Number 1 Region: 155-405
Classification Level Classification E-value
Superfamily Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 2.62e-68
Family Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 87-152
Classification Level Classification E-value
Superfamily Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain 1.05e-16
Family Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 411-483
Classification Level Classification E-value
Superfamily Pyrimidine nucleoside phosphorylase C-terminal domain 0.0000000000471
Family Pyrimidine nucleoside phosphorylase C-terminal domain 0.003
Further Details:      
 
Domain Number 4 Region: 16-65
Classification Level Classification E-value
Superfamily ADC-like 0.0000065
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495934|ref|YP_003542427.1|
Sequence length 489
Comment AMP phosphorylase [Methanohalophilus mahii DSM 5219]
Sequence
MELKVQPIDVKVGKYKVILNSIDAKELGVYEGDRVRVTGHVTVTAIVDFTEDMISPGMIG
LYHEIKEKLQREWTEIVEIEPAERPKSARIIRKNMDGERLAQEEIHGLVKDIVEENLSEI
ELAAFLTSTYINDMTDDETEWLTRAMIDTGEKLEFAKGPIMDKHSIGGVPGNKISLLVVP
IVAANGLLIPKTSSRAITGAGGTSDLMEVLAPVEFSATEVKEMTEKVGGVLVWGGATNIA
PADDKLIKVEYPLSIDPHCQLLASIMAKKGAVGADNVVIDIPTGPGTKIANVQQGRKLAR
DLINLGERLGMNVDCALTYGASPVGRTVGPALEVREALKVLETGEGPNSLIEKSMVLAGM
LLEMGGVAARGQGNELAMETLKNGKALAKFREIIEVQGGDPSVSYKDITVGEHTAEITAP
ANGYVLEFKNKRVVQIARLAGAPNDKGAGVLIHKKQGEPVKKANRFLSFMQKRKINWKQL
CRMPREILL
Download sequence
Identical sequences D5E6J4
gi|294495934|ref|YP_003542427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]