SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495977|ref|YP_003542470.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495977|ref|YP_003542470.1|
Domain Number 1 Region: 339-538
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.23e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 275-345
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000549
Family Domains B1 and B5 of PheRS-beta, PheT 0.016
Further Details:      
 
Domain Number 3 Region: 4-74
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000595
Family Domains B1 and B5 of PheRS-beta, PheT 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|294495977|ref|YP_003542470.1|
Domain Number - Region: 81-248
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000246
Family B3/B4 domain of PheRS, PheT 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495977|ref|YP_003542470.1|
Sequence length 539
Comment phenylalanyl-tRNA synthetase subunit beta [Methanohalophilus mahii DSM 5219]
Sequence
MPIITLDYEDLEKLTGTDRDSIIDRVPMIGADIERLEEKSIDIEFFPDRPDLYSVEGVSR
AMRGFMDIETGPVKYDIKHSDVEISLDDDIKNIRPVLACAIVRGVKFTESSIKALMDLQE
SLHWGLGRDRKKVSIGVHDLSRIKPPFRYIGADPSVEFVPLDFTEPMSLADILERHPKGT
RFAPLLEGYSKYPLILDAKDQVLSFPPIINGTLTMVDKNTTDLFIDVTGLSAEVYTALNI
VVAALADRGGRIESVKINYPDGESKFTPDLSPEKRIISMDEVKSLIGMDFTSDEVASHLR
RMRYAASPAGTNVVEIEIPPYRADILHNYDIIEDIAISVGFDNIEAIFPSTSTTGEAHPL
SLIQDNIREIMVGLGYSEVMPFTLTSEKVHFDNMRRPHTEDVTPVMHPISEDQTMIRTTL
LPNQLEILSLNQHHELPQRIFEVGEAIVNCANKLHLAATSIHALANFEEIREIVDSMMLE
RNIPYSVSPSEDPAFIEGRKADILVNGTKVGVMGEIHPQVILNFGLGQPVVGFEINLDE
Download sequence
Identical sequences D5E6N7
gi|294495977|ref|YP_003542470.1| WP_013037767.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]