SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495997|ref|YP_003542490.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495997|ref|YP_003542490.1|
Domain Number 1 Region: 128-204
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-21
Family Translational machinery components 0.0013
Further Details:      
 
Domain Number 2 Region: 44-115
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.35e-21
Family Ribosomal S5 protein, N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495997|ref|YP_003542490.1|
Sequence length 211
Comment 30S ribosomal protein S5P [Methanohalophilus mahii DSM 5219]
Sequence
MAYQYEEDWVPLTRLGSLVAEGQITSMDEAIESGLPIRESNIVDILLPGLEDEVLDINMV
QRMTDSGRRVKFRATVIVGNGDGYVGLGQAKDGQVGPAIRKAIRNAKMNITRVKRGCGSW
ECGCGLPHTVPSEVRGKAGSVNVELKPAPRGLGLAAGDTARKVLEKAGIKDVWTRTEGQT
RTTLNFAKATYNALKHTGTIREPLKMECKEA
Download sequence
Identical sequences A0A1L3Q2Z7 A0A1L9C447 A0A2D3C563 D5E6Q7
WP_013037787.1.47611 WP_013037787.1.50250 WP_013037787.1.51233 WP_013037787.1.52505 WP_013037787.1.98305 gi|294495997|ref|YP_003542490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]