SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294496003|ref|YP_003542496.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496003|ref|YP_003542496.1|
Domain Number 1 Region: 4-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000015
Family Ribosomal protein S14 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294496003|ref|YP_003542496.1|
Sequence length 50
Comment 30S ribosomal protein S14P [Methanohalophilus mahii DSM 5219]
Sequence
MVQTKKSFGRGASECRRCGRKQGLIRKYGIYLCRHCFREVAHEMGFEKYT
Download sequence
Identical sequences A0A139D145 A0A1B8X0D6 A0A1D2V0D0 A0A1L3Q309 A0A1L9C4E1 A0A285EXG9 A0A2D3C593 D5E6R3
WP_013037793.1.47611 WP_013037793.1.50250 WP_013037793.1.51233 WP_013037793.1.52505 WP_013037793.1.98305 gi|294496003|ref|YP_003542496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]