SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294496007|ref|YP_003542500.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496007|ref|YP_003542500.1|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily Ribosomal protein L14 6.8e-44
Family Ribosomal protein L14 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294496007|ref|YP_003542500.1|
Sequence length 132
Comment 50S ribosomal protein L14P [Methanohalophilus mahii DSM 5219]
Sequence
MKGMRSSVPKCLNAGARIDCVDNTGARTVEIISVKKYRGVKNRQPKAGLGDMCVVSVKKG
TPEMRRQILHAVVVRQKKEFRRPDGTRVSFEDNAVVITDPTGFPKGTDIKGPIAREVAER
FPKIGTTASMIV
Download sequence
Identical sequences A0A1L9C463 A0A2D3C3G7 D5E6R7
WP_013037797.1.47611 WP_013037797.1.50250 WP_013037797.1.98305 gi|294496007|ref|YP_003542500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]