SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294496044|ref|YP_003542537.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496044|ref|YP_003542537.1|
Domain Number 1 Region: 154-267
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.44e-18
Family Flavin-binding PAS domain 0.082
Further Details:      
 
Domain Number 2 Region: 261-323
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.77e-17
Family PYP-like 0.077
Further Details:      
 
Domain Number 3 Region: 10-125
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000258
Family Heme-binding PAS domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294496044|ref|YP_003542537.1|
Sequence length 326
Comment PAS/PAC sensor protein [Methanohalophilus mahii DSM 5219]
Sequence
MGEMTKGTTMENLLERILDTICKGMWAVDKDEVFIYFDKGMEEITGIKSEEVVGKKLEQY
MSASRHSVGDEAHFREMFLRARDSLKPIPYKTMPIVTKGGNLSFQTGRLIPLLDRKGNYD
GMICTVESVSEQKISQKTLRKRLRSDRKLEEIYKNSPVVAFLWTAEKDWPVEFVSGNISQ
FGYTPEDFTSGKLVYGDIICPEDLDMVRSEVNEHEIEGKIFFSKEYRILTKSGEIRWVIE
RSFIGRDEVGEPSYYQGIIIDITDRKMAEEAMRESEKKYRLIFENSPLGIFHFDENGIIT
HCNEKFPEIIAASREDIIGFNMVTSI
Download sequence
Identical sequences D5E6V4
gi|294496044|ref|YP_003542537.1| WP_013037834.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]