SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294496107|ref|YP_003542600.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496107|ref|YP_003542600.1|
Domain Number 1 Region: 121-218
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 2.09e-22
Family Siroheme synthase middle domains-like 0.0012
Further Details:      
 
Domain Number 2 Region: 6-114
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000109
Family Siroheme synthase N-terminal domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294496107|ref|YP_003542600.1|
Sequence length 238
Comment siroheme synthase [Methanohalophilus mahii DSM 5219]
Sequence
MYDRRYMPLFLDLSSQKVVIFGAGNVGQRKASLFYKFAEVTIISEEFSEDILAMYESNKI
DIVQINIREISSDMIRNYLDGAFLAIPATSDRDLNLKIHLIASDMDIFVNSVDSRGDVIV
PSVIKRGPVTIGISTLGHSPALSKYTRIKLEHTITPEYGKMAYLQDELRTELKKHIADQS
LRRQILWKVLDRREIWDAFEESYEKAYNIAYDIMLEQIENSADEDSKEQRDHCSNNGG
Download sequence
Identical sequences D5E717
gi|294496107|ref|YP_003542600.1| WP_013037897.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]