SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294496134|ref|YP_003542627.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496134|ref|YP_003542627.1|
Domain Number 1 Region: 50-323
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 3.54e-46
Family SAH/MTA deaminase-like 0.022
Further Details:      
 
Domain Number 2 Region: 13-50,325-366
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.0000802
Family Zn-dependent arginine carboxypeptidase-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294496134|ref|YP_003542627.1|
Sequence length 369
Comment amidohydrolase [Methanohalophilus mahii DSM 5219]
Sequence
MSSMAHEQVIYGNILYGEDLSLVKGYVCIRDGIIHEVCEEPTSSENIIAPCFTNCHTHIG
DSVCKDPCIGPAEDFVVKRDLNSLVRPPDGLKHRILAKTSDRELVEYMRTSIRDMLATGT
TGFADFREGGYRGVLALKDALKAMDIDSRIFARPDSREYNMPVHEGISLLLSQADGIGMS
GAHDIDLNLLTQIADSCHKSGRPFCIHAGEKSRHDIKDALSLQPDMLVHLTQAVQSDLKN
VADASIPVVVCPRSNFLTGVGIAPVAEMLKAGINVGVGTDNVMLNSVNMFSEMEFLSKVF
GLEDRQVFKMCTLNGASILEMEGKGPLLEGDKANLMVLDGTSNNLKGIQDVLSGLVRRAR
PDDILSIIH
Download sequence
Identical sequences D5E744
WP_013037924.1.50250 gi|294496134|ref|YP_003542627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]