SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294496224|ref|YP_003542717.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294496224|ref|YP_003542717.1|
Domain Number - Region: 145-204
Classification Level Classification E-value
Superfamily Flavoproteins 0.000309
Family Cytochrome p450 reductase N-terminal domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294496224|ref|YP_003542717.1|
Sequence length 231
Comment hypothetical protein Mmah_1576 [Methanohalophilus mahii DSM 5219]
Sequence
MTSAAGSASVEKLKNKLKEPAADIRYLLCRGYRRKGAIRFVSNHYRLAEEERHILTRLVF
DPETAAKRNEKRLTCSQLKGCDIFIDGYNVLITMESVLQNETVWFADDGFLRDTRGIFKN
HTNTTTTYQAVDEMLTTLSVLAVNSATILLDSQMSNSGKLAQYIRRRATKYPFTVEVRTS
KNVDFDLKQAGHLGVIATADSVIVDAVERAADLTACWMKIKGIQGESIGDN
Download sequence
Identical sequences D5E7D4
WP_013038014.1.50250 gi|294496224|ref|YP_003542717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]