SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294496431|ref|YP_003542924.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496431|ref|YP_003542924.1|
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.83e-64
Family Endonuclease III 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294496431|ref|YP_003542924.1|
Sequence length 206
Comment DNA-(apurinic or apyrimidinic site) lyase [Methanohalophilus mahii DSM 5219]
Sequence
MDTEEIFDRLKPLYPHEYFSTERDPFYILISTVLSQRTRDEVTEVASRRLFDQYSTPVQM
VEADVEKIEILIKDVGFYRVKAGRIKEISQILIDEYDSQVPASMVELLKLPGVGRKTANC
VLSYAFLEKAIAVDTHVHRISNRLGLVDTVTPDQTEIELQKQVPVSYWREVNELFVQFGK
TVCKPLSPACEVCAIEDLCAKKEKKK
Download sequence
Identical sequences D5E7Z1
WP_013038221.1.50250 gi|294496431|ref|YP_003542924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]