SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294496542|ref|YP_003543035.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294496542|ref|YP_003543035.1|
Domain Number - Region: 13-157
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.00847
Family NanE-like 0.089
Further Details:      
 
Domain Number - Region: 518-620
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0895
Family Histidine biosynthesis enzymes 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294496542|ref|YP_003543035.1|
Sequence length 798
Comment peptidase U32 [Methanohalophilus mahii DSM 5219]
Sequence
MNKKPELLAPAGDYDSLVAAVQNGADAVYFGGSAFSARGYADNFPDHNLGEAIDYAHLYG
VRVYVTVNTLIKDSEFSQAMDFLTQLCNMGVDAVIVQDIGLLVACRNHLPQLPVHASTQM
TVHNTESVKLLERYGVKRVVLSREMSLEEIAALNDNTDLEIEVFVHGALCISYSGQCLMS
SMIGGRSGNRGYCAQPCRRQYSLSCDDEIVAADYLLSPKDLCAARLIPELIAAGVDSFKI
EGRMKKPEYVAGVISVYRRLIDRYFADPTNFRVTESEIRYLEQLFNRGFTSAYLEGGTRD
MMGTVSPGNRGIPIGTVVGMSRYMDRAVVFLEQDLTVGDGIVSKAGEGEKIGVIYRAGRQ
EKSASAGDTIEIPFSGRLREGDILYRTLDCRQIKQLQQTYTSAAPQRKIPVIMQLEARLG
HPLSLSVEDEDCNTIALNCDYVVEAAKGKAASEKQLRKQLAKLGNTAFDPSSISIKMDDG
IFVPVGVLNDLRNDAVDLLRKKRTEKYHRKCSKPSLEPINNRAAANTNPLLCVAVSSVED
AGTAVAAGADVIYFTGLHMPSVDEIATVKKQCQSGGASLYLSTPRIIKNGEMKDLFWLLE
EARECSGLLVANAGMIGMASEKDIPFVTDTPLNIFNHHSCTVLKNLGARRVTASPELTLD
ELGQVADGCEGLECIVEGNFEVMVSEYCPLSHTSGCSDSCREGECVLVDRKGYSFPLKTD
EHCRTHLLNSRGLSMLDFLEDVTATGVSAIRIETRWESPGDIGRLVGLYRQVLDGRADTK
KMRAGKKYTTGHFYRGVL
Download sequence
Identical sequences D5E8A2
WP_013038332.1.50250 gi|294496542|ref|YP_003543035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]