SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294496575|ref|YP_003543068.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496575|ref|YP_003543068.1|
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.85e-55
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 305-423
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 5.36e-35
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0031
Further Details:      
 
Domain Number 3 Region: 203-297
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.16e-32
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294496575|ref|YP_003543068.1|
Sequence length 430
Comment nucleotide sugar dehydrogenase [Methanohalophilus mahii DSM 5219]
Sequence
MRVSIVGSGYVGSVTAACFAELGHEVICIDIDEEKVRQINDGYPPVWEEGLEELMNKHVG
KNLIATSDYDYAVQNTDVSFICVGTPSSDNGEIDLSIVAAASKSLGESIASKNAYHTVVV
KSTVVPGTTEGVVRSILEEYSARKAGETLGLAMNPEFLREGRAVHDFLNPDKIVVGSLDR
RSDSIVSGLYRDIDCEVTSVNLRTAEMIKYVNNAFLATKISFANEVGNICKRLGIDTYQV
MDAVGRDFRINPAFLNSGAGFGGSCFPKDVRALIGSAKDLDYYPSLLESVIEVNELQPLQ
MVEILEDKLPEIKDKRIAVLGLAFKNDTDDIRESRSIPVIRKLLEKGADIHAYDPLAADN
MKKVFPDITYASSAQEALEGAQACLLMTEWDEFRKLNTEFDSMDRKLLVDGRYLLDPEEL
EDVEYEGLCW
Download sequence
Identical sequences D5E8D5
WP_013038365.1.50250 gi|294496575|ref|YP_003543068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]