SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294496599|ref|YP_003543092.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496599|ref|YP_003543092.1|
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.72e-30
Family N-acetyl transferase, NAT 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294496599|ref|YP_003543092.1|
Sequence length 161
Comment (30S ribosomal protein S18P)-alanine acetyltransferase [Methanohalophilus mahii DSM 5219]
Sequence
MLFRRFEGRDFAEVLQIEMEAFEDHDPYTYMNFYEMNPEGFIVAESGKTITGFVMGYRSS
EQEGRIFSLAVKKEFQRKGIGQALLKVIQRHFRNRNVKYVRLEVRASNKSAQRLYNRMGF
IDCWYEPGYYIDGESGIIMKKYLYPAGLHEDLMADDWSAIS
Download sequence
Identical sequences D5E8F9
gi|294496599|ref|YP_003543092.1| WP_013038389.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]