SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495268|ref|YP_003541761.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495268|ref|YP_003541761.1|
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily FwdE-like 1.44e-52
Family FwdE-like 0.00054
Further Details:      
 
Weak hits

Sequence:  gi|294495268|ref|YP_003541761.1|
Domain Number - Region: 164-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0109
Family LIM domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495268|ref|YP_003541761.1|
Sequence length 195
Comment formylmethanofuran dehydrogenase, subunit E [Methanohalophilus mahii DSM 5219]
Sequence
MEIEDAIKFHGHLCPGLSLGFRVAKAAEEHFKNKRAEDEELVCIVENKSCSVDAIQVVNG
CTFGKGNLVYRDLGKHVYTFFNRGNDKALRLVIKPDGIKNDEEHQNLFPKIREGSATEEE
KKRFKQKHEDKSHEVLNMPLEEMFKIEEIEIKPPEKAVIFQTLICSECGEGMMESRARVM
NGNYYCLPCFEKYDI
Download sequence
Identical sequences D5EAB5
WP_013037059.1.50250 gi|294495268|ref|YP_003541761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]