SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495366|ref|YP_003541859.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495366|ref|YP_003541859.1|
Domain Number 1 Region: 59-213,351-490
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.25e-54
Family Tandem AAA-ATPase domain 0.0000167
Further Details:      
 
Domain Number 2 Region: 542-671
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 1.39e-31
Family XPF/Rad1/Mus81 nuclease 0.0000369
Further Details:      
 
Domain Number 3 Region: 694-748
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000035
Family Hef domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294495366|ref|YP_003541859.1|
Sequence length 754
Comment ERCC4 domain protein [Methanohalophilus mahii DSM 5219]
Sequence
MVKYIQHPLIKPDSAEQRLYQLDLAGKALSSSTLVVLPTGLGKTIVALLVMASRLETTGK
KVVMLSPTKPLVEQHAAFFSQMLNLKPEEVMTFTGNLPPAKREKMWEKGRVIVSTPQVIE
NDLLTKRISLRDVAHITFDEAHRAVGNYSYTYIAEEYFNQAKEPLCLAITASPGSSDEKI
AEVCESLHIEKVAVKTEDDSDVAPYIHHKQVEWVHLKLPDEMQSLKGLLDKVLEDRIQKL
DELGYRLPYGKKTSKKELLGLQRKMQGQLRSGNPDPSVYSSISLMAEILKAGHAIEVIET
QGVGALARYVDRLEREACTKGASKASKRLMEDLFMRQLSHRLKECGAEHPKLETVCNIVK
EQLTSNPDSRVIVFTNFRDTAEMVTDALSEIEDINPVKFVGQSSKYKDKGLTQKQQVEII
DHFKQGNFNVLVATSVAEEGLDIPATDLVVFYEPIPSEIRSIQRKGRTGRKHAGRVVVLV
TKGTRDEGYYWSSANREKKMQGNIKQLQETLATDEQENAFIKEKQRSLEDFDNNVEPADE
SGPEVVADQREIRSTVTRNLQKAGASLSVRTLEVGDYVVSENIAIERKESGDFVNSLIEG
KLFEQISNLTRTYEKTILIIEGGGLFNARRINPSSIYGAMLSISMDFETTILHTRDAEET
AALILQIAKRQQGKDKKPINPHGKKAAPILSKQQEYIVSAIPQLGPQAARNLLEHFGSVE
AVMKACEEELREVKLIGPKTAARIREVVCSEYKG
Download sequence
Identical sequences D5EAL3
gi|294495366|ref|YP_003541859.1| WP_013037157.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]