SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495430|ref|YP_003541923.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495430|ref|YP_003541923.1|
Domain Number 1 Region: 180-636
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 8.65e-133
Family beta-CASP RNA-metabolising hydrolases 0.0000039
Further Details:      
 
Domain Number 2 Region: 92-136
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.00000504
Family Prokaryotic type KH domain (KH-domain type II) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495430|ref|YP_003541923.1|
Sequence length 637
Comment KH-domain/beta-lactamase-domain protein [Methanohalophilus mahii DSM 5219]
Sequence
MVIEDILEGLKKKIEKNLPAGTTISNVEFEGPQLVVYTEEPRKFADNGNIVRTLAKSLRT
RIVVRPDPKVLLAPEESIDLINQTVPEDSGVTNYDFAPDVGEVIIEAEKPGLVIGKHGET
LREITKKVGWTPKVVRTPPIKSRTVKNIREFMKKNHSDRKDILKTIGRKIHRECTSKDQW
VRLTSLGGCREVGRSCFLLSTPESKIMIDCGVNVGSDDDMTPYLYIPEVQPLNQIDAVVI
THAHLDHQGLVPLLYKYGYDGPIYCTHPTRDLMVLLELDFIDVAAKDGKRIPYESADVRN
ALKHSIVLEYEEVTDIAPDIKLTFHNAGHIIGSAVSHFHIGDGLHNVVITGDFKYGPTRL
FNPAVNKFPRVETVITESTYGASNSMQPALKDAEKNLQRIIKETIDRQGVVLIPAFAVGR
SQEVMIVIEEAIRKGIIDEVPVYLDGMIWEATAIHATYPEYLNNDLRRLIFQKGQNPFLS
ECFKPVDSNELRRNIIENPHPCVILSTSGMMSGGPVMEYFKAFAPNERNTLVFVGYQADG
TLGRRIQKGWKEIPLSSGGKGSETVLMNMDVEIVDGFSGHSDRKQLMEFFKRMKPQPERV
FTEHGDERSCIDLASSIHKRKKIETRALTNLETIRLV
Download sequence
Identical sequences D5EAS7
gi|294495430|ref|YP_003541923.1| WP_013037221.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]