SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495552|ref|YP_003542045.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495552|ref|YP_003542045.1|
Domain Number 1 Region: 18-269
Classification Level Classification E-value
Superfamily MetI-like 3.4e-37
Family MetI-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495552|ref|YP_003542045.1|
Sequence length 283
Comment phosphate ABC transporter membrane protein 2, PhoT family [Methanohalophilus mahii DSM 5219]
Sequence
MDSRTTEKIAFGFLRACMWVVVAFVAVLILYIVFQGYNIMSWDFLTEMPKNRMTEGGIYP
ALVGTAYLVGISMAVAIPLGVLSAIYLNEYAKESRSKWIIEMAINNLAGTPSVVFGLFGL
ALFVKFLAFKPSIISASLTLSLLILPVVIRASKEALITVPLAHREASLALGVTKWKTIRS
IVLPEALPGIVTGIILSIGRVAGETAPIMFTGAAYFLPRLPESVFSQFMALPYHLYILAT
SGLNPMETRPIQYGTGLVLLILVLLINSIAIIIRKHYRKKLNR
Download sequence
Identical sequences D5EB49
gi|294495552|ref|YP_003542045.1| WP_013037343.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]