SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294496264|ref|YP_003542757.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496264|ref|YP_003542757.1|
Domain Number 1 Region: 164-355
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.25e-65
Family Actin/HSP70 0.00000054
Further Details:      
 
Domain Number 2 Region: 358-514
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.57e-62
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000023
Further Details:      
 
Domain Number 3 Region: 1-160
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.33e-57
Family Actin/HSP70 0.00000385
Further Details:      
 
Domain Number 4 Region: 481-578
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 1.44e-17
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294496264|ref|YP_003542757.1|
Sequence length 623
Comment chaperone protein DnaK [Methanohalophilus mahii DSM 5219]
Sequence
MGKILGIDLGTTNSCMAVIEGGEPTVLPNAEGSRTTPSVVGFSKKGEKLVGQVAKRQMVA
NPNNTVSSIKRHIGEGDYQVTLNDKEYTPQEISAMILRKLKEDAESYIGETITDTVITVP
AYFNDSQRQATKDAGKIAGLEVKRIINEPTAASLAYGLDKETGDHKILVYDLGGGTFDVS
ILELGDGVFEVLSTSGDTHLGGDDFDDRIVNHIISEFKKEEGIDLSGDKAAMQRFKDAAE
KAKIELSGVGTTNINLPFITADSNGQPKHVDIDITRAQFEKMTEDLIDKTLQSMKQALKD
ANLKTSDIEKVLLIGGSTRMPAVVRTVKEFIGKDPYKNINPDEAVAVGAAIQAGVMGGEV
EDVLLLDVTPLTLGIETMGGVATPLIERNTTIPTRKSQVFSTAADNQSSVEIHVLQGERG
IASANKTLGRFVLDGIPPAPRGMPQIEVTFDIDANGILHVSAKDKGTGKEQSITIEKPGG
LSDEEIDQMVKDAEAHAEEDKAKKEEVEARNNAETLVSSAEKALKDAGDIASEEQKTKVE
SAISDLNTALEGSDIEAIKSKTETLQEAMYEISALLYQKAQEEAEASGQAAGGEGASASD
SEGGSDEDVVDADFEEVDDNDKK
Download sequence
Identical sequences D5E7H4
WP_013038054.1.50250 gi|294496264|ref|YP_003542757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]