SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amath1|1046|gm1.1046_g from Amanita thiersii Skay4041 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amath1|1046|gm1.1046_g
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.85e-88
Family IF2B-like 0.000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Amath1|1046|gm1.1046_g
Sequence length 377
Sequence
MDSLTSIRASTDKLEILNQLLLPHVTQYEEITSIEDAYDSIKGAPAIASLAALAVSYHLT
RAINTSPPPHFLSSPIALKDHLNPILSYLFSARPTAVNLGAATRRLKKTLDYSITSGHIP
EKIAKNLVAEANAVADEDVGRNKAMAKHGGDWLVNCVDNAGEDNISLNLLTVCNTGSLAT
SGYGTALGLITYLYETGSLGRAYYTQTAPYHQGSRLTALELQTLQIPSMMICDTMVGSLF
QHHKIHAVVVGADRIAKNGDTANKIGTYNAAVLAARHKIPFIVVAPISTIDLEITDGTAI
PIEHRPAIEACLARGTLYPSRGKPEQALVMITPPGLDGVYNPSFDVTPAELITAIVTEKG
VAVREEGETCFDLKNIV
Download sequence
Identical sequences A0A2A9NTE8
jgi|Amath1|1046|gm1.1046_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]