SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amath1|148838|e_gw1.78.58.1 from Amanita thiersii Skay4041 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amath1|148838|e_gw1.78.58.1
Domain Number 1 Region: 20-149,421-547
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.15e-70
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0012
Further Details:      
 
Domain Number 2 Region: 215-394
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.94e-34
Family Group II chaperonin (CCT, TRIC), apical domain 0.00051
Further Details:      
 
Domain Number 3 Region: 157-220,387-422
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.14e-22
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Amath1|148838|e_gw1.78.58.1
Sequence length 564
Sequence
MSLKVPKANNLQLFKEGYKQAQGLEDAVLRNIQAVSELSDLVRTSFGPNGRNKLVINHLG
RLFVTSDAATIIREIEVVHPAAKLLVMASQAQESEMGDATNTVLIFAGELLKRAESLLVM
GLHPSEVIKGYELALAKALAELETLSTYSLPKPFTLEALASAFRPAIASKQYGFEDTLSK
LVAEAVLAVMPSNPKSFNVDNVRVVKIMGGNLSMSKVVQGMVFGREPEGMADDTSFLLHA
KVAVFTSALDISQTETKGTVLLKNADEMLNFTTGEEKQLEKIIKEIADAGVKVVIGGSSV
GELALHYFNRFNIAVIKVLSKFDLRRLCRVVNATPLARMGAPTPEEAGFVDVFETVEIGG
DRVTVLRQLVPGDQGYDPTGQGEKTRTATIVLRGATANHLDDLERAVDDGVNVVKSLMKD
SRLVPGAGATELELSKRVEEYGSGLKGLVQHAVKRYASALEVVPRTLVENAFGGAEGNEI
LSQLWTKHAREDGPVWGIDIELERDGTLRATEHEIYDSLAAKSWAIRLATEAAISVLSVD
SIIMSKPAGGPKVPQQAGNWDDDD
Download sequence
Identical sequences A0A2A9NMC3
jgi|Amath1|148838|e_gw1.78.58.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]