SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amath1|62648|fgenesh1_kg.54_#_46_#_isotig21116 from Amanita thiersii Skay4041 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amath1|62648|fgenesh1_kg.54_#_46_#_isotig21116
Domain Number 1 Region: 19-148,409-529
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.35e-82
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00063
Further Details:      
 
Domain Number 2 Region: 213-382
Classification Level Classification E-value
Superfamily GroEL apical domain-like 6.8e-47
Family Group II chaperonin (CCT, TRIC), apical domain 0.00039
Further Details:      
 
Domain Number 3 Region: 157-217,372-408
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 8.24e-27
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Amath1|62648|fgenesh1_kg.54_#_46_#_isotig21116
Sequence length 562
Sequence
MQRRLPIQPTIVLLKEGTDTSQGKPQLLSNISACLAIAETLASTLGPRGMDKLIVNERGE
AQITNDGATILKLLDIVHPAARTLVDIARAQDAEVGDGTTSVVLLAAQLLKEVRGLIEEG
VSPHIVMKGFRKASQLAIDCIKELQVSVDKSDPDRFRSLLLKCASTSMSSKLIHSEKPFF
ADMVVDAVLCLDQEDLDESLIGVKKIAGGGMQDSMLVKGVAFKKTFTYAGAEQQPKLFHD
PLILCLNVELELKAEKDNAEVRVDAVSEYQAIVDAEWEIIYRKLEAIEKTGARVVLSKLP
IGDLATQWFADRDIFCAGRVAAGDLRRVVQAVGGSIQSTCSDILPEHLGTCGLFEERQIG
GERYNIFEGCPKAKTCTLILRGGAEQFIEEVERSLHDAIMVVKRAVKNGDVVAGGGAIEM
ELSAHIRNHALTIPGKLQLIISAFAKALEIIPRQICDNAGLDTTDILNKLRMKHAHGERW
FGVDVDGPSGIRDNMEAFVWEPSLVKVNAISSAVEAACLILGVDETVRNPQSEGPNPGPK
APAGTAQRALRGRGRGMGIGRR
Download sequence
Identical sequences A0A2A9NGD0
jgi|Amath1|62648|fgenesh1_kg.54_#_46_#_isotig21116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]