SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292492411|ref|YP_003527850.1| from Nitrosococcus halophilus Nc4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292492411|ref|YP_003527850.1|
Domain Number 1 Region: 7-225
Classification Level Classification E-value
Superfamily Ribosomal protein L1 7.19e-81
Family Ribosomal protein L1 0.000000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292492411|ref|YP_003527850.1|
Sequence length 231
Comment 50S ribosomal protein L1 [Nitrosococcus halophilus Nc 4]
Sequence
MAKMGKRLAGIREKLEPGKVYSVEEAISLLKEAATAKFEESVDAAVNLGVDPRKSDQVVR
GSTVLPNGIGKTVRVAVFTQGANADAAKEAGADVVGLEDLAEKVKAGETDFDVVIASPDA
MRVVGQLGPILGPRGLMPNPKVGTVTTDVVGAVTKAKAGQVRYRTDKAGIIHCSIGKVSF
EVGALKQNLQALVEDLRKLKPASAKGVYLKKLTLSTTMGPGIAVDQATLSD
Download sequence
Identical sequences D5BVN4
WP_013033324.1.66814 gi|292492411|ref|YP_003527850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]