SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292491584|ref|YP_003527023.1| from Nitrosococcus halophilus Nc4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292491584|ref|YP_003527023.1|
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.49e-18
Family Toll/Interleukin receptor TIR domain 0.0043
Further Details:      
 
Domain Number 2 Region: 180-244
Classification Level Classification E-value
Superfamily DEATH domain 0.0000471
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292491584|ref|YP_003527023.1|
Sequence length 246
Comment TIR protein [Nitrosococcus halophilus Nc 4]
Sequence
MPDRIKIFVSYSHQDADYLEENSLLGFLKGLEKENIEFWTDQSIRPGELWDEVIKTQIQD
SHIALVLVSQGFLDSDYCQNTEIKHFLAHKAHLFPVILSPCDWRRHEWLKSRQFLPGGDQ
TVEEHFQDNGRRKRLFLQIREQLRERAELIRQSHYNGPSPPPPPGPFPGPFPGKVKIAFC
DRLGDDWKRLADCLEIRVSDQARFERGDEGRGIWVWLENRSRLSQLPAALREIKRGELAE
LLENFS
Download sequence
Identical sequences D5C179
gi|292491584|ref|YP_003527023.1| WP_013032525.1.66814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]