SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292492183|ref|YP_003527622.1| from Nitrosococcus halophilus Nc4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292492183|ref|YP_003527622.1|
Domain Number 1 Region: 219-679
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.72e-80
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00015
Further Details:      
 
Domain Number 2 Region: 80-211
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.51e-33
Family Ferredoxin domains from multidomain proteins 0.00032
Further Details:      
 
Domain Number 3 Region: 1-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.56e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.02
Further Details:      
 
Domain Number 4 Region: 809-886
Classification Level Classification E-value
Superfamily ADC-like 0.00000000192
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292492183|ref|YP_003527622.1|
Sequence length 903
Comment NADH-quinone oxidoreductase subunit G [Nitrosococcus halophilus Nc 4]
Sequence
MAVIHIDDQSYEVDAGHNLLQTCLSLGFDLPYFCWHPAMGSVGACRQCAVKQFQDEKDTQ
GRIVMSCMTPAQDGTRISIHNPEARAFRASIIEWLMINHPHDCPVCEEGGECHLQDMTQM
SGHTYRRYRFKKRTFRNQYLGPFIKHEMNRCIACYRCVRFYREYAGGHDLNVFATHHHVF
FGRHEDGVLENEFSGNLVEVCPTGVFTDKTLSARYTRKWDLQTAPSVCVHCSLGCNTSPG
ERYGELRRIQNRYNGEINGYFLCDRGRFGYDFVNSKRRIRQPRERKGEKTDPLNKPEARQ
HLASLLSQAGRIMGIGSPRASLEANFALRTLVGPANFYSGMAAREQQLVSLILDILKNSS
VHPASLQDAEQADAILILGEDVTNTAPRLALTLRQSVRQRAFEIADQQKIPHWQDSAVRE
AAQQQRSPLFIASPTATRLDDIATQTWQGAPEDLARLGFAIAHELNPDAPGIADLSGELG
ELAQSMAQALKSAKRPLVVSGTGCQSGTVLQAAANVALALRKDERPIDLLFTVPECNSLG
LGLMEGGDLDQAFKALEEGMADTLIVLENDLYRRADNRAIESALNRAQQLIVIDHLDHAT
AAKAQLVLPAATFAEGDGTLLNHEGRAQRFFQVFVPEGDIQESWRWLSEAMAPAGSKEGL
WQRLDEVTRACAESIASLQDITQAAPPAKFRLQGMRIARESHRYSGRTAMGAHRNVHEPK
TPEDPDSPFSFSMEGYYGQLPGALIPYFWAPSWNSIQSVNKFQEEVGGPLRGGDPGVRLI
EPPSGAKIAYFTQTPPPFQRRVDQWLILPLYHIFGSEELSALAPAIAERAPAPYLALHPE
DAAQLEVEPSGQVELILAGKSYHLPVRHQDSLPLGVAGIPWGLPAWKARVALPAWGQLSK
GAP
Download sequence
Identical sequences D5C512
WP_013033100.1.66814 gi|292492183|ref|YP_003527622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]