SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292492467|ref|YP_003527906.1| from Nitrosococcus halophilus Nc4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292492467|ref|YP_003527906.1|
Domain Number 1 Region: 223-754
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.07e-203
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000383
Further Details:      
 
Domain Number 2 Region: 768-913
Classification Level Classification E-value
Superfamily ADC-like 1.1e-42
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00047
Further Details:      
 
Domain Number 3 Region: 14-131
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.32e-32
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.03
Further Details:      
 
Domain Number 4 Region: 139-212
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000363
Family Ferredoxin domains from multidomain proteins 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292492467|ref|YP_003527906.1|
Sequence length 936
Comment formate dehydrogenase subunit alpha [Nitrosococcus halophilus Nc 4]
Sequence
MAANPEVLQEGELISFKLNGRKMSAQPGETILQVAKRNGVLIPHLCYQESMRPDGNCRAC
MVEIKGERVLAPSCCRQPSEGMEVETDNQRARHSQKMVLELLLSDMPEKAYTLHSELDHW
ARELRLGPPRFSARKQAPADLSHPAMAVNLDACIQCTRCVRACREEQVNDVIGYAFRGPH
STIVFDQGDPMGESTCVACGECVQACPTGALMPAGGVGLIQSDKAVESVCPYCGVGCQLT
YKIKENRILYVEGRDGPANHGRLCVKGRYGFDYVHHPHRLTKPLIRRQEAPPKSADLVMD
PANPYTVFREASWEEALEFAAAGLKKIRGEKGPKALAGFGSAKGSNEEAYLFQKLVRTGF
GSNNVDHCTRLCHASSVAALLECIGSGAVSNPVADVGQAQVVILIGANPTVNHPVGATWI
KNAIKRGTRLIVMDPRRSELVRHATYFLQFKPGTDVALLNALMHTIIEEGWVNPSFIAER
TEAFEEMKRHLQVYSPEAMAPVCGIPAQTLREVARLYATSKGSMILWGMGISQHTYGTDN
ARCLISLALMTGQIGRRGTGLHPLRGQNNVQGASDAGLIPMVFPDYQRVDNVEAQAKFEA
LWDSSLDAQPGLTVVEVMEAITAGKLHGMYIEGENPAMSDPDAHHAREALAKLEHLVVQD
IFLTETAYLADVILPASAYPEKTGTFTNTDRWVQLGRQAINPPGEARQDLWIIQEMARRL
GLEWNYSGPATVFAEMRRAMPSIAGITWERLERESAVVYPCRQEGDPGEPVVFIDNFPTS
SGRGKFVPADILPPDERPDKEYPWVLITGRQLEHWHTGSMTRRAAVLDAIEPEAVASLHP
LDLEELGVKPGGWVTLASRRGQVTLEARADDAVPRHAVFMAFCYYEAAANLLSNPALDPV
AKIPEFKYCAIKVSAGGQAPRLSSYGGGQTEQSIPL
Download sequence
Identical sequences D5BVU0
gi|292492467|ref|YP_003527906.1| WP_013033379.1.66814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]