SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284928667|ref|YP_003421189.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928667|ref|YP_003421189.1|
Domain Number 1 Region: 57-233
Classification Level Classification E-value
Superfamily alpha/beta knot 1.05e-43
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0000346
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily L30e-like 0.000000000000612
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284928667|ref|YP_003421189.1|
Sequence length 236
Comment rRNA methylase, putative, group 3 [cyanobacterium UCYN-A]
Sequence
MAALENDRQLNRIWVTNKLRHDSRFSNLLRISKSKGAVVDEVSLQRLSQITNGSNHQGIA
AQVSPYSYYTLDRLITKAKQESDQPVIIIADGIVDPQNLGAIIRTSEAMGCQGLIIPQRR
AASITSSVAKVAAGALEFFPIARVINLNRALETLKAEGFWIYGTVAEGGKNLPNFDFSCA
IGLVIGSEGNGLNLLTQRYCDELLSIPLEGKTSSLNASAAASISIYEIFRSRSINN
Download sequence
Identical sequences D3EMY1
gi|284928667|ref|YP_003421189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]