SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284928720|ref|YP_003421242.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928720|ref|YP_003421242.1|
Domain Number 1 Region: 2-200,231-314
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.83e-84
Family ATP synthase (F1-ATPase), gamma subunit 0.0000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284928720|ref|YP_003421242.1|
Sequence length 314
Comment ATP synthase F1 subcomplex subunit gamma [cyanobacterium UCYN-A]
Sequence
MANLKAIRDRIDSVKNTKKITEAMRLVAAAKVRRAQERVVSTRPFANILANVLYNLLNRL
KYGDVDLSLLKQRAVKTVAIVVISGDRGLCGGYNSYVIRRAEKRIKELQDKGINPCLITI
GRKSTQYFSKRKISVKAKYIGLEQIPTSDDAMPIADELISLFLSETVDRVELVYTRFVSL
INSSPVVQTLAPLNLQGLEPEDDEIFRLITREGEFQVERQTIEKPVHNLSQDMIFEQDPV
QILDALLPLYINNQLLRALQESAASELAARMTAMSNASENATQLAGSLTMSYNKARQASI
TQQLMEVVAGANAL
Download sequence
Identical sequences D3EN34
gi|284928720|ref|YP_003421242.1| WP_012953549.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]