SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284928809|ref|YP_003421331.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928809|ref|YP_003421331.1|
Domain Number 1 Region: 4-227
Classification Level Classification E-value
Superfamily PHP domain-like 2.35e-33
Family PHP domain 0.012
Further Details:      
 
Domain Number 2 Region: 775-861
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0000000000000196
Family Intein (protein splicing domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284928809|ref|YP_003421331.1|
Sequence length 873
Comment DNA-directed DNA polymerase III PolC [cyanobacterium UCYN-A]
Sequence
MSFVGLHVHSAYSLLDGASQLDALVDRAIQLGMPAIALTDHGVMYGAIELIKVCKNKNIK
PIIGNEMYVINGDITEKKRYKKYHQVVLAKNTQGYKNLSKLTTISHLEGVQGKGIFSRPC
INKELLEKYHDGLIVTSACLGGEIPQKILSGDFQGAKEVAQWYKKIFANDFYLEIQDHGS
TEDRIVNVSISKIAQDLNIKIIATNDSHFTSCYDVEAHDALLCIQTAKLISDEKRLRYSG
TEYLKSIDEMKLLFRDHLDDDLIKEAINNTLEVANKIDTYHILGEPRIPDFPVPIGHDLD
SYVREISLQGLLERLNCKSINQVSEEYQQRLEYELDMLEKMGFSSYFLVVWDYIKYARDN
EIPVGPGRGSAAGSLVAYSLKITNIDPIYHGLLFERFLNPERKSMPDVDTDFCIERRDEM
IKYVTKKYGEKNVAQIITFNRMTSKAVLKDVARVLDIPYSESDKMTKMIPVTRGKPTKLK
VMVSNETPSPEFKDRYDQDPLVRRWLDMAIRIEGTNKTFGVHAAGVVISSESLDEIVPLQ
KNNDGAVITQYYMEDLESLGLLKMDFLGLRNLTTIQRAADLIEKNRNIKLDVEQLPTDER
KALKELEQGKISKLPTDIEKTHKLLGDGELEGIFQLESSGMKQIVKDLKPSGIEDISSIL
ALYRPGPLDAGLIPKFINRKHGKEAIKYEDKLLEPILKETYAVLVYQEQIMTMAQQLAGY
SLGEADLLRRAMGKKKASEMEKHQKNFIDGSLNNGVSRSVAENLFQQMVKFAEYCLSYDT
KVLTVEYGLLPIGRIVQENIKCKVYTINNQGVIYTQPIAQWHDRGKQEIFEYCLDDETVI
QATKDHKFMTTDNVMMPIDQIFEEGLELKKIKL
Download sequence
Identical sequences D3ENC3
gi|284928809|ref|YP_003421331.1| WP_012953638.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]