SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284928848|ref|YP_003421370.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928848|ref|YP_003421370.1|
Domain Number 1 Region: 537-954
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.01e-131
Family DNA polymerase I 0.0000000238
Further Details:      
 
Domain Number 2 Region: 9-157
Classification Level Classification E-value
Superfamily PIN domain-like 1.23e-45
Family 5' to 3' exonuclease catalytic domain 0.0000492
Further Details:      
 
Domain Number 3 Region: 347-530
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.94e-42
Family DnaQ-like 3'-5' exonuclease 0.00018
Further Details:      
 
Domain Number 4 Region: 193-303
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 5.23e-30
Family 5' to 3' exonuclease, C-terminal subdomain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284928848|ref|YP_003421370.1|
Sequence length 955
Comment DNA polymerase I [cyanobacterium UCYN-A]
Sequence
MTNQKDLPLLILIDGHSLAFRAYYAFLNSRRGLLKTSTGIPTSICFGFLNSLMQVIKVEK
PKYVAIAFDSKEKTFRHKFDVSYKAGRPETPENFIVDIKNLQKVLEILNLFTITMPGYEA
DDILGTLATEASNKGYRVKILSGDKDTFQLISDEQNISVLYLGRSGVNSSSEKGYTEIIS
KTVIERLGIASFQVVDYKALCGDKSDNIPGVKGIGEKTAVKLLTEYKTIESIYENIEHIK
GANQKKLKEGKSEAEHSRYLAKIITNCPLVFNIDEFKLVGFDQATAQNIFEKLELKKFRE
NINQLQKNLGGEIPHQSLQKVEEAINEQQTNKNNKEICIKPLIINDILQLDKLINILTEY
QDINYPIAWDTETTGLNPQTAKLVGISCCWGEEVNNIAYIPIEHKEGEQLSKEKVLEKLR
PILENKCYPKVFQNAKFDRLVLLNQGIQLNGVVFDTMLASYVINPDKSHKLSSLCKQYLT
NISSQDYLELKINKQQTIADLDITQVANYCGMDAYSTFLLVKPLKKRLAEIPILEKLFLE
VEQSLEKVLSKMENQGILIDIEYLNNLSEQNKVNLLCLEEKIYEEAKEKFNLESPKQLSK
ILFENLQLSTKKSKKITTGYSTNHAILEKLKGDHPIIDYLLKYRTLSKLQSTYIDNLPTL
VSNQTHRIHTSFNQSVTSTGRLSSSKPNLQNIPIRTELSRKIRKAFISPKKWLLVSADYS
QIELRILAHLSQEPLLVKAYCDCQDIHTLSAQLLFDKEEITIEERNLGKTINFGVIYGMG
SQRFAREAGVTPTKGKDFIKKYHQRYKKVFQFLENLKIEAITKGYVTTILGRRRYFNFYS
DSLRNLYGCNPDEINLDELKYSYSDSQLLRSAANAPIQGSSADIIKVAMIKIEKLLRNYQ
AKLLLQVHDELVFEIPLEELEELQSEIKQIMENSVKLTIPLLVEINSGINWMEAK
Download sequence
Identical sequences D3ENG2
WP_012953677.1.87152 gi|284928848|ref|YP_003421370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]