SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284928894|ref|YP_003421416.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928894|ref|YP_003421416.1|
Domain Number 1 Region: 60-335
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.63e-65
Family Alanine racemase-like, N-terminal domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 311-469
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.95e-51
Family Eukaryotic ODC-like 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284928894|ref|YP_003421416.1|
Sequence length 478
Comment diaminopimelate decarboxylase [cyanobacterium UCYN-A]
Sequence
MVSKSEHIFRTGQDYISKYTNEILQKSPNNCLLPLTSKTTEDDFLEIGECNIKDLVEKFG
SPLYILDEKTLRTSCKQYRDNFKLYYKGSSQVIYASKAWSCLSVVGIIATENLGFDVVSG
GEFHTVQIAMSKLGYSEIEIANRVYFHGNNKSLDELELAIKANCNIVVDNWLELQNLVEL
GSCLPEKSIRILLRLTPGIECHTHEYIKTGHVNSKFGFNLNDFETVINYVIKQKVLNCRG
LHSHIGSQIFEKQPHRDLAFILVKLLKKSQELGLTLSELNIGGGLGISYTSDDNPPSIEE
WVKNVSESVMEACLDSNLSFPKLIAEPGRSLIGSAGVTAYTVGSRKEIPGLHTYLAIDGG
MSDNPRPITYQSLYSILIGNKMSEKITETFIIAGKHCESGDIIIKDAQLPQTHTGDILVV
MGTGAYNYSMASNYNRIPRPAAVLVNHGEANLIVRRETYDDLVKQDCLPQRLLPNCIL
Download sequence
Identical sequences D3ENK8
WP_012953723.1.87152 gi|284928894|ref|YP_003421416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]