SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284928962|ref|YP_003421484.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928962|ref|YP_003421484.1|
Domain Number 1 Region: 13-364
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 3.66e-74
Family Iron-containing alcohol dehydrogenase 0.00000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284928962|ref|YP_003421484.1|
Sequence length 369
Comment glycerol dehydrogenase-like oxidoreductase [cyanobacterium UCYN-A]
Sequence
MDYPSSDVIDYFSIAPAHIIKGENVISKIGENITHLGTRPLIVGGEKTLPITDNNLRTIL
KKHKEIVVVSKSYSPECSETSLKHLTSLVHEHKADVIIGVGGGKALDMAKILAYCNRLPI
VTIPTSGATCAAWTALSNIYTHQGIFKYDVSLSRCPDILILDYSIIRTAPQRTLIAGIGD
AIAKWYEASISLKNVNNRQVLTMTAIQQAKTIKNILLQKSYIAINNIYGKEWFEVVDACI
LLAGIVSGLGGSNCRTVAAHAVHNGLTNIKTVHTILHGEKVAYGILVQLRLEEIMQNSQL
AAISRQQLLKFYQKIGLPRNLKELGLDKITKEELNLIAQIICRPDSDIHRLPFTVSSKQL
LLAMRSTAQ
Download sequence
Identical sequences D3ENS6
WP_012953791.1.87152 gi|284928962|ref|YP_003421484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]