SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284928995|ref|YP_003421517.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928995|ref|YP_003421517.1|
Domain Number 1 Region: 244-755
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.81e-145
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000115
Further Details:      
 
Domain Number 2 Region: 39-240
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 6.8e-49
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284928995|ref|YP_003421517.1|
Sequence length 770
Comment ribonucleoside-diphosphate reductase, subunit alpha [cyanobacterium UCYN-A]
Sequence
MQSTVSNFSQQNNNPGDTNTSHLNHYSNLGASKIKVERRDGSWAALDIGKIRAVVSWACS
GKDVNSIALEAGLTTRLRDGITTKDIQNNLINCTLEMCSPQEPDWRYVAGRLHIWSLWKN
ILVSRGYQYDKYEFTVQTKVENRQYDKRLLTYSLEELKEAGSWINSDWDIDYDYAGAVLL
SSRYLLPDELPQEALLTCALLLAIVEAPQNRLPWAKRFYEAIATRKISLATPILANLRVP
EGSLTSCFIIAIDDDLESICEGVTNAARISKNGGGVGANVSRIRATGSWVMGKANASGGI
IPWVKLLNDTAIAVNQGGRRAGAITISVDIWHLDIPEFLEMQTENGDQRRKAYDVFPQLV
LTDEFMRRVENKQEWTLVDPYEVRTKLGIELAELWGEEFERAYTLIESELGNKITLYKKI
NARELFKNIMRSQIETGMPYLAFKDTINRANPNKHVGYIPSVNLCTESFSNVDPRKESHC
CNLVSLNLANIEESEIGYLSSLAVRILDNTIDITNPPFSYAKAHNDRYRTIGVGCMGLAD
WLAKRFLTYDDINAISQLFEEVGYWCTHTSMELSKERGAYNAFAGSDWSKGKLIGSKPVD
WFIENASQKERWVELSENIKTYGIRNSHITAIAPNTSSSLVQGCTASILPVYSRFFYDKW
AKGTVPIAPPFIKESFWFYHENKVLDQQKVIKAVSAIQEWIDTGISMELLFNLNKGIYLP
EEPESSLSATDIFKMFVTAWKNGCKAIYYVRTVQKDDFKDFDNTCTSCAN
Download sequence
Identical sequences D3ENV9
gi|284928995|ref|YP_003421517.1| WP_012953824.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]