SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929067|ref|YP_003421589.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929067|ref|YP_003421589.1|
Domain Number 1 Region: 6-232
Classification Level Classification E-value
Superfamily Ribosomal protein S2 1.26e-93
Family Ribosomal protein S2 0.000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929067|ref|YP_003421589.1|
Sequence length 272
Comment 30S ribosomal protein S2P [cyanobacterium UCYN-A]
Sequence
MPVVSLSELLESGVHFGHQTRRWNPKMSQYIYTARNGVHIIDLVQTAQLMEDAYQYVRNG
SDKGKRFLFVGTKRQAAGIIAQEASRCGANYVNQRWLGGMLTNWETIKTRVERLKELEAM
EESGQIEKRPKKEGAVLRRELGKLQKYLGGIKTMRRPPDVVVIVDQRREYNAIQECQKLG
IPMISLLDTNCDPDYADIPIPANDDAIRSIKLILGKLADAIDEGSHRRVNANDDYETSDE
SFIENNIEKIEESTSVSSSLEGENIEEKENQA
Download sequence
Identical sequences D3EP31
WP_012953896.1.87152 gi|284929067|ref|YP_003421589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]