SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929070|ref|YP_003421592.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929070|ref|YP_003421592.1|
Domain Number 1 Region: 181-313
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.85e-41
Family ATP-dependent riboflavin kinase-like 0.00025
Further Details:      
 
Domain Number 2 Region: 20-185
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.19e-30
Family Adenylyltransferase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929070|ref|YP_003421592.1|
Sequence length 314
Comment FMN adenylyltransferase /riboflavin kinase [cyanobacterium UCYN-A]
Sequence
MIYSKFGVWIPSSIDNAKTPTAVALGNFDGIHLGHRQVLKPILKFAKQYVPTVVTFEPHP
QEFFTGETRQLLTPIDEKVQILNSLNIKQLIRLPFNQDLASLSPLEFIIDILVGKLNVRY
ISVGENFYFGHKKTGTVELLRDFTERFGISVNTIRLETFLTSDKKNPLRISSSKIREYLA
DGSIAEVNQMLGYSYFLRGIVISGQQIGRTIGFPTANLKLPTNKLLPCNGVYCVYVEFEN
KDIIKGVMNVGKRPTIDGSLTVEVHLLDWSGNLYGKKLTVYLEKFLRYETKFPSLQALRN
QIEQDCKKARSILI
Download sequence
Identical sequences D3EP34
gi|284929070|ref|YP_003421592.1| WP_012953899.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]