SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929083|ref|YP_003421605.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929083|ref|YP_003421605.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.18e-105
Family BC ATP-binding domain-like 0.0000000115
Further Details:      
 
Domain Number 2 Region: 681-942
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.77e-100
Family BC ATP-binding domain-like 0.000000124
Further Details:      
 
Domain Number 3 Region: 396-551
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 7.85e-53
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000823
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.25e-48
Family BC N-terminal domain-like 0.00000231
Further Details:      
 
Domain Number 5 Region: 557-683
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.18e-46
Family BC N-terminal domain-like 0.00000279
Further Details:      
 
Domain Number 6 Region: 944-1079
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.7e-35
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929083|ref|YP_003421605.1|
Sequence length 1081
Comment carbamoyl-phosphate synthase large subunit [cyanobacterium UCYN-A]
Sequence
MPRRDDLKKIMILGAGPIVIGQACEFDYSGTQACKALREEGYEVILVNSNPASIMTDPEM
SDRTYIEPLVPDIVEKIIAKERPDALLATMGGQTALNIAVSLAKSGVLEKYNVELIGARL
SAIEKAEDRELFKKAMDSIGVPVCPSGIANTLKEAREIAINIGSYPLIIRPAFTLGGTGG
GIAYHQEEFEDIVQTGLDASPMSQILVEQSLLGWKEYELEVMRDLADNVVIICSIENFDP
MGVHTGDSITVAPAQTLTDKEYQKLRDYSKSIIREIGVETGGANIQFSVNPANGDTIVIE
MNPRVSRSSALASKATGFPIAKFAAKLAVGYTLNEISNDITRKTPASFEPTLDYVVTKIP
RFAFEKFPGSQAILTTQMKSVGEVMAIGRTFQESFQKALRSLETGFNGFTCDQKSTLPSP
SEVRSELQISSPDRIYTIYKALKLDITIEEIHNLTAIDIWFLDKLKDIFDTEKYLRQIIL
KNIDKEKMRVIKQKGFSDCQIASITNHTEDEVRKYRKSLGVIPVYKVVDTCAAEFEAFTP
YYYSTYELEDTEVLFTKKPKIMILGGGPNRIGQGIEFDYCCCHASFALSQDGYETIMVNS
NPETVSTDYDTSDRLYFEPLTREDILNIIEVENPEGVIIQFGGQTPLKLAVPLQEYFDNP
SSCVQTKIWGTPPDSIDLAEDRERFEKILCDLQIKKPPGGIARSFEQSLSIASNIGYPVV
VRPSYVLGGRAMRIVYSDKELKHYMDYAIQVEPDHPILIDKFLEDAVEVDVDALCDKTGM
VVIGGIMEHIEQAGVHSGDSACSIPFTTLSEKVLDIIRKWTSQLANSLQVIGLINIQYAV
QQEEVYILEANPRASRTVPYVSKATGRPLAKIASLVISGKTLSELGVHKELIPRYVAVKE
AVLPFQKFPGTDTLLGPEMRSTGEVMGIDYDFGKAFAKAAIASGINLPINGTVFISTSDR
DKILTVPIAKDLEKLGFKIVATSGTQKVLENNGIIGVETILKLHEGRPHVIDWIKNKKIQ
FIINTPNGEESQVDAQKIRRTALDYQLPVITTIAGAKATVTAIRSLQNQPLNVQALQDYI
C
Download sequence
Identical sequences D3EP47
gi|284929083|ref|YP_003421605.1| WP_012953912.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]