SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929109|ref|YP_003421631.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929109|ref|YP_003421631.1|
Domain Number 1 Region: 44-222
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000144
Family GAF domain 0.009
Further Details:      
 
Domain Number 2 Region: 264-467
Classification Level Classification E-value
Superfamily PP2C-like 0.0000549
Family PP2C-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929109|ref|YP_003421631.1|
Sequence length 468
Comment serine phosphatase [cyanobacterium UCYN-A]
Sequence
MAIKSISSESSKKNILAGSSSTTESTPVLALKEIVANLCREQNKIQNLLSSLGFALRSFN
NLNQFLELAPLMAARVTDADCSALILVNNSGYLSLEQLHCQDHQMNQEIREAISSVINKT
NNKQINSILSTSLDEKISNVLGKKSCLYSTPILVKNVERGRIYIFSSDSEYSWTQTKRKL
LQLVSDQTSVAIANNELTVELRSKERQDRELEIASEIQLRLLPRQCPKIKGVNLAARCQT
ASRVGGDYYDFIPTNYDQFLQNKDFKQDDRFTCVPWSIVIGDVMGKGVPAGLIMTMTRGM
LRAEVLHRHSPAQILQHLNHFMYVDLDNSHRFVTLFYSEYNPQNGCLSYSNAAHNPPLLW
KGAAHNIQKLDTEGMLIGLDPDSQYEDGQVQLSSGDVVLYYTDGFTDAVNKKGLRFDEKN
LIKVFEEGCQKYKNSQEILDYVFNQIENFVGSENDDNDDMTLVVMQIE
Download sequence
Identical sequences D3EP73
WP_012953938.1.87152 gi|284929109|ref|YP_003421631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]