SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929121|ref|YP_003421643.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929121|ref|YP_003421643.1|
Domain Number 1 Region: 79-423
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-70
Family Extended AAA-ATPase domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000513
Family ClpX chaperone zinc binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929121|ref|YP_003421643.1|
Sequence length 434
Comment ATP-dependent Clp protease ATP-binding subunit ClpX [cyanobacterium UCYN-A]
Sequence
MSKYDSHLKCSFCGKSQENVRKLIAGPGVYICNECVDLCNEILLDEDSTVESTAESTSSS
QYKRIYSKRYSEKSGSSFEKISKPIEVKNYLDEYVVGQDEAKKVLSVAVYNHYKRLNFLQ
EKDKQVEDNIVDLQKSNILLIGPTGSGKTLLAQTLAKILEVPFAIADATSLTEAGYVGED
VENILFKLLQVADLDIHKAQRGIIYIDEIDKIACKNENFSTTRDVSGEGVQQALLKILEG
TIANVSPNGGRKHPHQNCIQINTKDILFICGGAFISLDGIIDKRINKKSVGFVYSKDSYS
DQGTIDLRQKVNSDDLIKFGMIPELIGRLPVIASLNTLTEETLATILTKPRNALVKQYQK
LLSMDDIELEFTKEAIKEIAEEAYRRKVGARALRGIIEELMLDIMYELPSHRNIQKFIIT
KKMVQKRSTAELLI
Download sequence
Identical sequences D3EP85
WP_012953950.1.87152 gi|284929121|ref|YP_003421643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]