SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929129|ref|YP_003421651.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929129|ref|YP_003421651.1|
Domain Number 1 Region: 152-426
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.31e-76
Family Spermidine synthase 0.00000402
Further Details:      
 
Domain Number 2 Region: 4-115
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 1.26e-38
Family Bacterial S-adenosylmethionine decarboxylase 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929129|ref|YP_003421651.1|
Sequence length 427
Comment S-adenosylmethionine decarboxylase proenzyme [cyanobacterium UCYN-A]
Sequence
MNSLGRHILVEFFGCSSEILNNVSVIESSMLVAAQEAGATVINSTFHHFSPFGVSGVVVI
QESHLAIHTWPEYRYAAVDLFTCGDTVNPWISFDRLKILFKADYGSALELNRGQLELLER
IDIDLGELRDETTNKLVIPKISRSVWLTDRNENVALSIRHKGEHIFYEKSPYQTVEIFDT
FEYGKMLTIDKMVMCTEKDENAYHEMIVHVPMLLNPSFSNVLVIGGGDGGSVRELIRHSH
IQKITIVEIDETIIRASKQYLPSLSSQLNNEKVDLHIEDGITFIHNTDNEQYDLIIVDSS
DPVGPAEGLFSYEFYRQIYRCLKPDGAMAANTESPCFNQKVFVDINNCLSDIFGKENVHS
YLSFIPTYPTGMWSFGYARKGSMHPLKNFDSEQAEIFTKKHNLKYYNPGIHRSAFCLPTF
VQNMLNE
Download sequence
Identical sequences D3EP93
WP_012953958.1.87152 gi|284929129|ref|YP_003421651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]