SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929227|ref|YP_003421749.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929227|ref|YP_003421749.1|
Domain Number 1 Region: 12-146
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.83e-26
Family N-acetyl transferase, NAT 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929227|ref|YP_003421749.1|
Sequence length 185
Comment ribosomal-protein-alanine acetyltransferase [cyanobacterium UCYN-A]
Sequence
MSYESLKLYTPRVNEIDELVSLDKICLGGLWTLDNYERELQSPNSHFLVLSTNSVGAIIG
CGCFWRILEEAHITLLMINPSYQSQGLGQLLLYSLLKNAVSSHLEHATLEVRASNKSAIG
LYEKFGFKIAGRRKKYYKKTGEDALIFWKSDLNSPVFQQELSSWKKLINKRLINSCYLPP
DLICY
Download sequence
Identical sequences D3EPG8
gi|284929227|ref|YP_003421749.1| WP_012954055.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]