SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929294|ref|YP_003421816.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929294|ref|YP_003421816.1|
Domain Number 1 Region: 2-231,358-405
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.17e-80
Family Tandem AAA-ATPase domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 713-929
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 7.59e-72
Family Helical scaffold and wing domains of SecA 0.0000101
Further Details:      
 
Domain Number 3 Region: 406-515,614-711
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.92e-50
Family Tandem AAA-ATPase domain 0.00000974
Further Details:      
 
Domain Number 4 Region: 230-358
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 5.49e-43
Family Pre-protein crosslinking domain of SecA 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929294|ref|YP_003421816.1|
Sequence length 932
Comment protein translocase subunit secA [cyanobacterium UCYN-A]
Sequence
MFKTLFGDPNTRKIKKFHPVVAEINALEADIHKLSDQQLKYKTNEFRELLETVNSDEELR
NILNEILPEAFAVVREASIRVLGMRHFDVQLIGGMVLHKGQIAEMKTGEGKTLVGTLPAY
LNGLTKKGVHIVTVNDYLARRDAEWMGQVHRFLGLSVGLIQSGMNPEERRKNYSCDITYT
TNSELGFDYLRDNMATSMSEVVQRPPYYCIIDEVDSILIDEARTPLIISGQVERPTEKYL
KATEIAKHLEKQLSEDDQKEYEVDEKARNVLMTDQGFEKAEKLLGVQDLYDQENPWAHYI
FNAVKAKELFTKDVNYIVKNQEVVIVDEFTGRVLAGRRWSDGLHQAIEAKEEVPIQKETQ
TLATITYQNFFLLYNQLSGMTGTAKTEETELEKIYNLQVTIIPTNRPSQRHDNPDVVYKT
EKAKWKAVAQEVEEFHKLGRPILVGTTSVEKSDVISALLQEKNIPHNILNARPENVERES
EIVAQAGRKGAVTIATNMAGRGTDIILGGNSDYMARLKIREYLMPQVVIPEDNNLTKEKK
ISNTNSRGFGQDQNKKKWQPSVDIFPTQLSQKTQELIKSVVKFAVDKYGLQSVTELEAEE
KIAIASENAPTEDVFVLKLREVYKIIRQEYDVYTDAEHDEVVKLGGLYVMATERHESRRV
DNQLRGRSGRQGDPGTTKFFLSLEDNLLRIFGGDRVVGLMNAFRVEEEMPIESKMLTRSL
EGAQKKVETFYYDTRKQVFEYDEVMNNQRRAIYAERRRVLEGLDLKEQVLQYAEKTMDEI
VDAYVNPELPPEEWDVKNLVNKIKEFVYLLKDIVAEDVEEMTVGEMKIFLHEEVRKAYDI
KENQVDKTRPGLMREAERFFILQQIDTLWREHLQSMDALRESIGLRGYGQKDPLIEYKQE
GYEMFLEMMVDIRRNVVYSLFQFQPQEQPPTV
Download sequence
Identical sequences D3EPN5
WP_012954122.1.87152 gi|284929294|ref|YP_003421816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]