SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929302|ref|YP_003421824.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929302|ref|YP_003421824.1|
Domain Number 1 Region: 20-48
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.0000000235
Family Subunit XII of photosystem I reaction centre, PsaM 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929302|ref|YP_003421824.1|
Sequence length 48
Comment photosystem I reaction center subunit XII [cyanobacterium UCYN-A]
Sequence
MKQSREVVHLLTLRSLRPMLSNAQIFIALAIALVPGILAFRLSTELYK
Download sequence
Identical sequences D3EPP3
gi|284929302|ref|YP_003421824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]