SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929376|ref|YP_003421898.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929376|ref|YP_003421898.1|
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.68e-58
Family G proteins 0.000000162
Further Details:      
 
Domain Number 2 Region: 308-408
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.51e-32
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000114
Further Details:      
 
Domain Number 3 Region: 215-311
Classification Level Classification E-value
Superfamily Translation proteins 5.11e-30
Family Elongation factors 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929376|ref|YP_003421898.1|
Sequence length 409
Comment translation elongation factor 1A [cyanobacterium UCYN-A]
Sequence
MAREKFERNKPHVNIGTIGHVDHGKTTLTAAITMTLAAAGNAKARNYEDIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLAKQVGVPSLVVFLNKQDQVDDEELLELVELEVRELLSEYDFPGDDIPIVSGSALMAIE
ALKENAKIKPGENPWTDKILALMEAVDASISEPEREIDKPFLMAVEDVFSISGRGTVATG
RIERGKVKVGETVSIVGIRDTQTTTVTGVEMFQKTLDEGLAGDNVGLLLRGSKKDDIERG
MVIAKTDSITPHTLFEGEVYVLTKEEGGRHTPFFKNYRPQFYVRTTDVTGTIQDYTADDG
TAVEMVMPGDRIKMTVELISAIAIEQGMRFAIREGGRTIGAGVVSKILK
Download sequence
Identical sequences D3EPW7
gi|284929376|ref|YP_003421898.1| WP_012954204.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]