SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929420|ref|YP_003421942.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929420|ref|YP_003421942.1|
Domain Number 1 Region: 113-307,405-553
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.79e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000236
Further Details:      
 
Domain Number 2 Region: 285-418
Classification Level Classification E-value
Superfamily GAD domain-like 5.89e-30
Family GAD domain 0.0026
Further Details:      
 
Domain Number 3 Region: 3-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.19e-27
Family Anticodon-binding domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929420|ref|YP_003421942.1|
Sequence length 587
Comment aspartyl-tRNA synthetase [cyanobacterium UCYN-A]
Sequence
MDLGTNVTLFGWVDRRRDHGGVIFIDLRDHTGIIQIVSDPKHNSSSYETAERLRNEYVIK
IIGKVSCRPSDSLNSKMKTGEIEIYADSIEILSVVNKKLPFSISGSEEELIKEETRLRYR
YLDLRREKMLSNLQLRHKVIKTIRHYLEDYQNFIEVETPILTRSTPEGARDYLVPSRVNF
GQWYALPQSPQLFKQLLMVSGFDRYYQVARCFRDEDLRADRQPEFTQLDMEMSFMSEDEI
LDLNEGLICHIFKTIKNVELSRPFPRLTYQYVMENYGTDCPDTRFDLTLVDVSDILRNSK
FKVFSEAIKNSGSVKVLPIPEGNSAISNVRIKSGGDLFQEAVESGSKGIVYIRVKEDSQI
ETIGAIKDNLTNEQKKDLLEKTGAKPGHLLLISAGDTALVNKSLSRLRLIIGKQMNLIDK
NKINLLWVTEFPLFEWNPDEQRFESLHHPFTCPNTSDLNDLTTARAQAYDLIFNGIEVGG
GSLRIYQKDIQKKVFQTIGLSEEEIHNKFQFILDAFEYGAPPHGGIAYGLDRLIMLLAEE
ESIRDVIAFPKTQQASCLLTESPSSVDFKQLQELQVTSTYKSVDQKN
Download sequence
Identical sequences D3EQ11
gi|284929420|ref|YP_003421942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]