SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929430|ref|YP_003421952.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929430|ref|YP_003421952.1|
Domain Number 1 Region: 232-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.26e-44
Family Nitrogenase iron protein-like 0.0000014
Further Details:      
 
Domain Number 2 Region: 128-204
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.000000000000131
Family Domain of the SRP/SRP receptor G-proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929430|ref|YP_003421952.1|
Sequence length 435
Comment signal recognition particle-docking protein FtsY [cyanobacterium UCYN-A]
Sequence
MSNWPNDQSHSENKNISQEYYISWAQKAYKHIQEEKIIDKLDDAKINATETVNSSSVNIS
NSANESSTNTPTWMQKSNRLEALKENATELTTANSEISVEFDKEFVWSAKILADQGRKPE
DITEDEIQWLKSLHKGLSKTRRGLLNQLKLVLGQGPLSENAILEIETILLQADIGINATD
YIVTTLQNKLLEESLPSEKAIEYLKTILCDILNSPLKQAYDSEILVKKEVLNIWLLTGVN
GAGKTTTIGKLAYLAQQCGHSCIIAAADTFRAAAVEQVKIWGEKTNTPIISNSGKNTDPA
AVVYDGLMAAQARNVDLLLVDTAGRLQNKTNLMEELAKIRRVIDKKAKNNVHIESLLVID
ATLGQNGLRQTELFSEAAHLTGVILTKLDGSSKGGIALAITQQFGLPIRFIGVGENMKDL
KPFSSHEFVEALLDE
Download sequence
Identical sequences D3EQ21
gi|284929430|ref|YP_003421952.1| WP_012954258.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]