SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929502|ref|YP_003422024.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929502|ref|YP_003422024.1|
Domain Number 1 Region: 131-317
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.08e-48
Family ATP-binding domain of peptide synthetases 0.0000479
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.32e-35
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929502|ref|YP_003422024.1|
Sequence length 319
Comment glutathione synthase [cyanobacterium UCYN-A]
Sequence
MKLAFVVDPISELEPNHDSTIAMIEAAQDLGHEVWVTKINKLSIIEGKAWARMSRIEVDL
TFFREKQKPKNISWYEISSQRLVCLDDMNVVFMRKDPPVNIRYLYATYILDLINPINTLV
LNSPRGLREANEKIYALQFHQFMPPTIVGKDKEIIHDFVHTYKTAVLKPLGGKAGEGILI
LNLQDPNLNSIIEISTHQGQEPVMIQQFLPEAKYGDKRIILLNGNPIGAVNRVPTGQEFR
GNMAVGGRVEKAEISLQEHDMCKVLGKKLRQDGLYFVGIDIIGGYLTEINVTSPTGIREI
DSLDQKNLGQEVIKWVTSQ
Download sequence
Identical sequences D3EQ93
gi|284929502|ref|YP_003422024.1| WP_012954330.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]