SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929532|ref|YP_003422054.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929532|ref|YP_003422054.1|
Domain Number 1 Region: 11-233
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.02e-55
Family PP-loop ATPase 0.00049
Further Details:      
 
Domain Number 2 Region: 212-314
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 2.09e-18
Family MesJ substrate recognition domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929532|ref|YP_003422054.1|
Sequence length 319
Comment tRNA(Ile)-lysidine synthetase [cyanobacterium UCYN-A]
Sequence
MWTSLHTKVHKTLQNSLILPPKKRILVAVSGGQDSLCLLKIIMDLRIKWDWEVSIAHCDH
GWPSDTGISDHVKKISEEWNIDFYLKRTQILKITESIAREWRYKVLLEVARENNFTAIVT
GHTLSDLAETVLYNLIRGAGSHGLSVLTNTRPLTNSINLVRPLLNTSRTETLFFCRQLNL
PVWEDEVNTNFDYARNRIRKQLVPYLKLNFNPQVEKTLYQASKVLKAESDYLEKEAGKIL
KLASNKKKTQLNKKILQTIPLALQRRVIRMFLQHNKLQAPNFEQVEEGVKLINSPHGSQT
SSFSVQVVLEVYDDYIVKK
Download sequence
Identical sequences D3EQC3
gi|284929532|ref|YP_003422054.1| WP_012954360.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]