SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929554|ref|YP_003422076.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929554|ref|YP_003422076.1|
Domain Number 1 Region: 8-190
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.12e-45
Family Phosphoglucomutase, first 3 domains 0.00043
Further Details:      
 
Domain Number 2 Region: 268-375
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.06e-30
Family Phosphoglucomutase, first 3 domains 0.0021
Further Details:      
 
Domain Number 3 Region: 166-267
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.67e-25
Family Phosphoglucomutase, first 3 domains 0.00075
Further Details:      
 
Domain Number 4 Region: 376-461
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.12e-18
Family Phosphoglucomutase, C-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929554|ref|YP_003422076.1|
Sequence length 463
Comment phosphoglucosamine mutase [cyanobacterium UCYN-A]
Sequence
MSNQSFYSLNTPLFGTDGIRGKAGDLLTASFAVQLGFWAGEVLKSEKTVPGPIIIGQDSR
NSSDMLAMSIASGLASTGIDVWYLGLCPTPCVAYITNTSEAIGGIMISASHNPPEDNGIK
FFDTNGIKLSTAISQKIEEGLRGELLPTVSQKKLWGKILYKNNLINNYYDFLRKSLPPSF
SCRGMRIVLDLAWGASVNIAPNIFKQLDATVFSLHEEPKGELINVNCGSTNLKLLQQAVE
KYKADIGFAFDGDADRVMAVDNTGQIVDGDFILFLWGKYLMQKGNLPDNLLVTTIMANLG
FEKAWEKLGGTLIRTPVGDRYVQAKMIETGAKLGGEQSGHIICHNHGISGDGIQTSLQIC
SLLQQSETSLSKLVENSFKPYPQILHNIRFKDRNSLNLWKDCEALQKGIEVAKQSMKSNG
RVLVRASGTEPLLRIMIESESSDIAQYWINYLVSIVEKYLNIK
Download sequence
Identical sequences D3EQE5
WP_012954382.1.87152 gi|284929554|ref|YP_003422076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]