SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929569|ref|YP_003422091.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929569|ref|YP_003422091.1|
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 2.62e-20
Family Ribosomal protein L29 (L29p) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929569|ref|YP_003422091.1|
Sequence length 78
Comment 50S ribosomal protein L29P [cyanobacterium UCYN-A]
Sequence
MALPKIGEIRDLDDKDLAAEVLAAKKKLFDLRFQQATRQLEKTHEFKHTRHRIAQLLTVE
RERQLSKNNSKSTPSKGE
Download sequence
Identical sequences D3EQG0
WP_012954397.1.87152 gi|284929569|ref|YP_003422091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]