SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929674|ref|YP_003422196.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929674|ref|YP_003422196.1|
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.75e-40
Family Phosphoglucomutase, first 3 domains 0.0012
Further Details:      
 
Domain Number 2 Region: 257-388
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.77e-25
Family Phosphoglucomutase, first 3 domains 0.0025
Further Details:      
 
Domain Number 3 Region: 161-271
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.81e-23
Family Phosphoglucomutase, first 3 domains 0.0021
Further Details:      
 
Domain Number 4 Region: 389-478
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 9.03e-21
Family Phosphoglucomutase, C-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929674|ref|YP_003422196.1|
Sequence length 480
Comment phosphomannomutase [cyanobacterium UCYN-A]
Sequence
MTFNQNPIKFGTDGWRGVIAADFTFERVAIVAPLCAQVLLNNYGTVSNSHTIIVGYDRRF
LAEEFAKIAAESLIEAGFDVVFAESYAPTPAFSWAVKSQNALGAIVLTASHNPGKYLGIK
VKGAFGGSVSSEITQQIENLLYEMPKFSGKTGILSYFDPWKSYSQELKSKVNIKKIQQAV
HNKDLTIFADVMYGAAASGLERLLECPIQEINSNRDPLFGGNPPEPLPCYLTKLLTTVKK
FNAEKSSGLSIGLVFDGDGDRIAAVDKQGNFLSSQILLPILMDHLATHKGLKGEIVKTVS
GAGLISYLADFYNLPIHETSIGYKYIANRMLNGNVLIGGEESGGIGYGTHIPERDALLSA
LYLLEAIVESSDDLGEYYLKLQKKVNFFNAYDRIDLPLSSLDIRSKLIKHLETKSFNEIA
NKTVLKCDKKDGYKYYLTDQSWLLIRFSGTEPTLRLYCESLTLKQVNNILEWVKNWVNSI
Download sequence
Identical sequences D3EQR5
gi|284929674|ref|YP_003422196.1| WP_012954502.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]